missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AP2M1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 529.00 €
Specifications
| Antigen | AP2M1 |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18400951
|
Novus Biologicals
NBP1-89055 |
0.1 mL |
529.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18491361
|
Novus Biologicals
NBP1-89055-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
AP2M1 Polyclonal antibody specifically detects AP2M1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| AP2M1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol | |
| 1173 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Adaptin-mu2, adaptor-related protein complex 2, mu 1 subunit, AP-2 mu chain, Clathrin assembly protein complex 2 medium chain, clathrin coat adaptor protein AP50, Clathrin coat assembly protein AP50, Clathrin coat-associated protein AP50, clathrin-associated/assembly/adaptor protein, medium 1, HA2 50 kDa subunit, KIAA0109, mu subunit, Plasma membrane adaptor AP-2 50 kDa protein, plasma membrane adaptor AP-2 50kDA protein | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title