missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16115254

biliverdin reductase B (flavin reductase (NADPH)), Mouse, Polyclonal Antibody, Abnova™

Product Code. 16115254
Change view
Click to view available options
Quantity:
50 μL
Unit Size:
50µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16115254 50 μL 50µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16115254 Supplier Abnova Supplier No. H00000645A01.50uL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse polyclonal antibody raised against a partial recombinant BLVRB.

The final step in heme metabolism in mammals is catalyzed by the cytosolic biliverdin reductase enzymes A and B (EC 1.3.1.24).[supplied by OMIM

Sequence: VACTSAFLLWDPTKVPPRLQAVTDDHIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ

Specifications

Antigen biliverdin reductase B (flavin reductase (NADPH))
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant BLVRB.
Formulation 50% glycerol
Gene BLVRB
Gene Accession No. NM_000713
Gene Alias BVRB/FLR/MGC117413/SDR43U1
Gene Symbols BLVRB
Host Species Mouse
Immunogen BLVRB (NP_000704, 107 a.a. ∼ 206 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 645
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.