missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ AKT1/2/3 Inhibitor Peptide Set
Shop All Bio Techne Products
Click to view available options
Quantity:
2 mg
5 mg
Unit Size:
2mg
5mg
Specifications
Specifications
| Host Species | Human |
| Components | Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361 |
| For Use With (Application) | Inhibition of Akt kinase activity |
| Content And Storage | Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. |
| Quantity | 2 mg |
| Product Type | AKT1/2/3 Inhibitor Peptide Set |
| Molecular Weight (g/mol) | 4214 |
| Inhibitors | AKT1/2/3 |
| Form | Lyophilized |
For Research Use Only
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction