missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ AKT1/2/3 Inhibitor Peptide Set

Product Code. 18145235 Shop All Bio Techne Products
Click to view available options
Quantity:
2 mg
5 mg
Unit Size:
2mg
5mg
This item is not returnable. View return policy

Product Code. 18145235

Brand: Novus Biologicals™ NBP229332

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

For use in research applications

TRUSTED_SUSTAINABILITY

Specifications

Host Species Human
Components Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
For Use With (Application) Inhibition of Akt kinase activity
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Quantity 2 mg
Product Type AKT1/2/3 Inhibitor Peptide Set
Molecular Weight (g/mol) 4214
Inhibitors AKT1/2/3
Form Lyophilized

For Research Use Only

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.