missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Custom Products and Services
  4. Custom Enzymes and Inhibitors
  5. Novus Biologicals™ AKT1/2/3 Inhibitor Peptide Set

Novus Biologicals™ AKT1/2/3 Inhibitor Peptide Set

Product Code. 18115332 Shop All Bio Techne Products
Click to view available options
Quantity:
2 mg
5 mg
Unit Size:
2mg
5mg
This item is not returnable. View return policy

Product Code. 18115332

Brand: Novus Biologicals™ NBP2293325MG

Please to purchase this item. Need a web account? Register with us today!

994.50 EUR valid until 2025-12-16
BEST PRICE on Promo! Use promo code "24090" to get your promotional price.
Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

For use in research applications

TRUSTED_SUSTAINABILITY

Especificaciones

Host Species Human
Components Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
For Use With (Application) Inhibition of Akt kinase activity
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Quantity 5 mg
Product Type AKT1/2/3 Inhibitor Peptide Set
Molecular Weight (g/mol) 4214
Inhibitors AKT1/2/3
Form Lyophilized

For Research Use Only

Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado