missing translation for 'onlineSavingsMsg'
Learn More

ADAMTS7 Antibody, Novus Biologicals™

Product Code. 18145088 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18145088 0.1 mL 0.1mL
18659335 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18145088 Supplier Novus Biologicals Supplier No. NBP238539

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody has been used in 1 publication

ADAMTS7 Polyclonal specifically detects ADAMTS7 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.
TRUSTED_SUSTAINABILITY

Specifications

Antigen ADAMTS7
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q9UKP4
Gene Alias A disintegrin and metalloproteinase with thrombospondin motifs 7, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 7, ADAM metallopeptidase with thrombospondin type 1 motif, 7, ADAM-TS 7, ADAMTS-7, ADAM-TS7a disintegrin and metalloprotease with thrombospondin motifs-7 preproprotein, COMPase, DKFZp434H204, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.82
Gene Symbols ADAMTS7
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LGRAHIRAHTPACHLLGEVQDSELEGGLAAISACDGLKGVFLLSN
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11173
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.