missing translation for 'onlineSavingsMsg'
Learn More

STAU2 Antibody [HRP], Novus Biologicals Biologicals™

Product Code. 30500555 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30500555 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30500555 Supplier Novus Biologicals Supplier No. NBP338039H

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

STAU2 Polyclonal antibody specifically detects STAU2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen STAU2
Applications ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate HRP
Formulation PBS
Gene Alias DKFZp781K0371,39K2, double-stranded RNA-binding protein Staufen homolog 2,39K3, MGC119606, staufen (Drosophila, RNA-binding protein) homolog 2, staufen homolog 2, staufen, RNA binding protein, homolog 2 (Drosophila)
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human STAU2 (NP_001157852.1).,, Sequence:, PEYGQGMNPISRLAQIQQAKKEKEPDYVLLSERGMPRRREFVMQVKVGNEVATGTGPNKKIAKKNAAEAMLLQLGYKASTNLQDQLEKTGENKGWSGPKPG
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 27067
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.