missing translation for 'onlineSavingsMsg'
Learn More

STAU2 Antibody [HRP], Novus Biologicals Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP3-38039H

Product Code. 30500555

682.00 € / 0.10mL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. Rückgaberichtlinie anzeigen

Beschreibung

STAU2 Polyclonal antibody specifically detects STAU2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence

Spezifikation

Antigen	STAU2
Classification	Polyclonal
Formulation	PBS
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	27067
Content And Storage	Store at 4°C in the dark.
Form	Purified

Applications	ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Conjugate	HRP
Gene Alias	DKFZp781K0371,39K2, double-stranded RNA-binding protein Staufen homolog 2,39K3, MGC119606, staufen (Drosophila, RNA-binding protein) homolog 2, staufen homolog 2, staufen, RNA binding protein, homolog 2 (Drosophila)
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 300-400 of human STAU2 (NP_001157852.1).,, Sequence:, PEYGQGMNPISRLAQIQQAKKEKEPDYVLLSERGMPRRREFVMQVKVGNEVATGTGPNKKIAKKNAAEAMLLQLGYKASTNLQDQLEKTGENKGWSGPKPG
Quantity	0.1 mL
Primary or Secondary	Primary
Target Species	Human, Mouse, Rat
Product Type	Antibody
Isotype	IgG

Produktvorschläge

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

STAU2 Antibody [HRP], Novus Biologicals Biologicals™

Beschreibung

Spezifikation

Produktvorschläge

Dokumentation

Aktionen