missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glycogenin 1 Antibody [DyLight 755], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35107IR
This item is not returnable.
View return policy
Description
Glycogenin 1 Polyclonal antibody specifically detects Glycogenin 1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| Glycogenin 1 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Western Blot | |
| DyLight 755 | |
| EC 2.4.1.186, glycogenin, glycogenin 1, glycogenin-1, GN1, GN-1, GSD15, GYG | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 234-333 of human Glycogenin 1 (NP_001171649.1).,, Sequence:, EAHDPNMTHPEFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ | |
| 0.1 mL | |
| metabolism | |
| 2992 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction