missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MCART1 Antibody [DyLight 755], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-37910IR
This item is not returnable.
View return policy
Description
MCART1 Polyclonal antibody specifically detects MCART1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| MCART1 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 92014 | |
| Store at 4°C in the dark. | |
| Purified |
| ELISA, Western Blot | |
| DyLight 755 | |
| CG7943, FLJ37273, MGC14836, mitochondrial carrier triple repeat 1, mitochondrial carrier triple repeat protein 1 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MCART1 (NP_219480.1).,, Sequence:, MMDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITFPIQKVLFRQQLYGIKTRDAILQLRRDGFRNLYRGILPPLMQKTTTLALMFG | |
| 0.1 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction