missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Collagen V Polyclonal antibody specifically detects Collagen V in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | Collagen V |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | PE |
| Formulation | PBS |
| Gene Alias | alpha 1 type V collagen, Collagen 5, collagen alpha-1(V) chain, collagen, type V, alpha 1, Collagen-5, EC 2.7.7.6, EC 6.1.1 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human Collagen V (NP_000084.3).,, Sequence:, LPPLLLLLLWAPPPSRAAQPADLLKVLDFHNLPDGITKTTGFCATRRSSKGPDVAYRVTKDAQLSAPTKQLYPASAFPEDFSILTTVKAKKGSQAFLVSIY |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?