missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
JNK3 Polyclonal antibody specifically detects JNK3 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | JNK3 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | c-Jun N-terminal kinase 3, EC 2.7.11, EC 2.7.11.24, JNK3 alpha protein kinase, JNK3A, JNK3FLJ12099, MAP kinase 10, MAP kinase p49 3F12, MAPK 10, MGC50974, mitogen-activated protein kinase 10, p493F12, p54bSAPK, PRKM10FLJ33785, stress activated protein kinase beta, Stress-activated protein kinase JNK3 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human JNK3 (NP_620448.1).,, Sequence:, NRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMN |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?