missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. GTP binding protein era homolog Antibody, R&D Systems™

GTP binding protein era homolog Antibody, R&D Systems™

Catalog No. 18444001 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
25 μL
0.1 mL
Packungsgröße:
0.10 Milliliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Menge Packungsgröße
18444001 25 μL 25 Mikroliter
18255966 0.1 mL 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Catalog No. 18444001 Lieferant Novus Biologicals Lieferanten-Nr. NBP18970325ul
  • ONLINE EXCLUSIVE PRICE
    457.09 €
    391.65 € / 25µL
    Save 65.44 €
    14% Off
 Eingeschränkter Artikel
Estimated Shipment: 01-12-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

GTP binding protein era homolog Polyclonal specifically detects GTP binding protein era homolog in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen GTP binding protein era homolog
Anwendungen Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50
Zusammensetzung PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gen-Alias CEGA, Conserved ERA-like GTPase, ERA, Era (E. coli G-protein homolog)-like 1, Era G-protein-like 1 (E. coli), ERAL1A, ERA-like protein 1, ERA-W, GTPase Era, mitochondrial, GTPase, human homolog of E. coli essential cell cycle protein Era, GTP-binding protein era homolog, HERA, H-ERA, HERA-A, HERA-B
Gensymbole ERAL1
Wirtsspezies Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SVLVMNKVDCLKQKSVLLELTAALTEGVVNGKKLKMRQAFHSHPGTHCPSPAVKDPNTQSVGNPQRIGWPHFKEIFMLSALSQEDVKTLKQY
Reinigungsverfahren Affinity Purified
Menge 25 μL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 26284
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Isotype IgG
Produktlinie Novus
Mehr anzeigen Weniger anzeigen

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.