missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. TMEPAI Antibody, R&D Systems™

TMEPAI Antibody, R&D Systems™

Product Code. 18600439 Shop All Bio Techne Products
Change view
Click to view available options
Menge:
25 μL
Unit Size:
25 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Menge Unit Size
18600439 25 μL 25 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18600439 Supplier Novus Biologicals Supplier No. NBP25665725ul
 Eingeschränkter Artikel
Estimated Shipment: 02-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

TMEPAI Polyclonal specifically detects TMEPAI in Human samples. It is validated for Immunocytochemistry/Immunofluorescence, Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen TMEPAI
Anwendungen Western Blot, Immunocytochemistry, Immunofluorescence
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Zusammensetzung PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gen-Alias prostate transmembrane protein, androgen induced 1, Solid tumor-associated 1 protein, STAG1prostate androgen induced RNA, transmembrane prostate androgen-induced protein
Gensymbole PMEPA1
Wirtsspezies Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VNSTAAAAAGQPNVSCTCNCKRSLFQSMEITELE
Reinigungsverfahren Affinity Purified
Menge 25 μL
Regulatorischer Status RUO
Forschungsgebiet Signal Transduction
Primär oder sekundär Primary
Gen-ID (Entrez) 56937
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Produkttyp Antibody
Form Purified
Isotype IgG
Produktlinie Novus
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.