missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. TIPRL Antibody, R&D Systems™

TIPRL Antibody, R&D Systems™

Catalog No. 18605417 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
25 μL
100 μL
Packungsgröße:
100 Mikroliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Menge Packungsgröße
18605417 25 μL 25 Mikroliter
18217584 100 μL 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Catalog No. 18605417 Lieferant Novus Biologicals Lieferanten-Nr. NBP25502425ul
  • ONLINE EXCLUSIVE PRICE
    457.09 €
    391.65 € / 25µL
    Save 65.44 €
    14% Off
 Eingeschränkter Artikel
Estimated Shipment: 01-12-2026
Zum Warenkorb hinzufügen
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

TIPRL Polyclonal specifically detects TIPRL in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifications

Antigen TIPRL
Anwendungen Immunocytochemistry, Immunofluorescence, Immunofluorescence
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
Zusammensetzung PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gen-Alias dJ69E11.3, MGC3794, putative MAPK activating protein, Putative MAPK-activating protein PM10, TIP41, TOR signaling pathway regulator-like (S. cerevisiae), TIP41-like protein, TIP41Type 2A-interacting protein, TIPTIP41, TOR signalling pathway regulator-like (S. cerevisiae)
Gensymbole TIPRL
Wirtsspezies Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RIDGVLIRMNDTRLYHEADKTYMLREYTSRESKISSLMHVPPSLFTEPNEISQYLPIKEAVCEKLI
Reinigungsverfahren Affinity Purified
Menge 25 μL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 261726
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Produkttyp Antibody
Isotype IgG
Produktlinie Novus
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.