missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. Odf1 Antibody - Azide and BSA Free, R&D Systems™

Odf1 Antibody - Azide and BSA Free, R&D Systems™

Catalog No. 18606580 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
0.02 mL
0.1 mL
Packungsgröße:
0.02 Milliliter
0.10 Milliliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Menge Packungsgröße
18606580 0.1 mL 0.10 Milliliter
18659650 0.02 mL 0.02 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Catalog No. 18606580 Lieferant Novus Biologicals Lieferanten-Nr. NBP2936010.1ml
 Eingeschränkter Artikel
Estimated Shipment: 03-12-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Descrizione

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Odf1 Polyclonal specifically detects Odf1 in Human, Mouse, Rat samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifica

Antigen Odf1
Anwendungen Western Blot
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 1:500-1:2000
Zusammensetzung PBS (pH 7.3), 50% glycerol
Gen-Alias cancer/testis antigen 133, CT133, HSPB10, MGC129928, MGC129929, ODF, ODF2, ODF27, ODFP, ODFPG, ODFPGA, ODFPGB, outer dense fiber of sperm tails 1, outer dense fiber of sperm tails, 27-kD, outer dense fiber protein 1, outer dense fibre of sperm tails 1, RT7, SODF
Wirtsspezies Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human ODF1 (NP_077721.2). LYCLRPSLRSLERKAIRAIEDEKRELAKLRRTTNRILASSCCSSNILGSVNVCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPC
Reinigungsverfahren Affinity purified
Menge 0.1 mL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 4956
Zielspezies Human, Mouse, Rat
Inhalt und Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotype IgG
Produktlinie Novus
Vedi altri risultati Mostra meno risultati
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.