missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. Abnova™ Human GATA4 Partial ORF (NP_002043.2, 343 a.a. - 442 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human GATA4 Partial ORF (NP_002043.2, 343 a.a. - 442 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No. 16108554
Ansicht ändern
Click to view available options
Menge:
10 µg
25 ug
Packungsgröße:
10 Mikrogramm
25 Mikrogramm
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Menge Packungsgröße
16108554 10 µg 10 Mikrogramm
16118554 25 ug 25 Mikrogramm
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Catalog No. 16108554 Lieferant Abnova™ Lieferanten-Nr. H00002626Q01.10ug
 Eingeschränkter Artikel
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Used for AP, Array, ELISA, WB-Re

This gene encodes a member of the GATA family of zinc-finger transcription factors. Members of this family recognize the GATA motif which is present in the promoters of many genes. This protein is thought to regulate genes involved in embryogenesis and in myocardial differentiation and function. Mutations in this gene have been associated with cardiac septal defects. [provided by RefSeq]

Sequence: ASGASSNSSNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQTSSKQDSWNSLVLADSHGDIITA

Spezifikation

Zugriffsnummer NP_002043.2
Zur Verwendung mit (Anwendung) Antibody Production, ELISA, Protein Array, Western Blot
Zusammensetzung 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gen-ID (Entrez) 2626
Molekulargewicht 36.74kDa
Name GATA4 (Human) Recombinant Protein (Q01)
Qualitätskontrollen 12.5% SDS-PAGE Stained with Coomassie Blue.
Menge 10 µg
Immunogen ASGASSNSSNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQTSSKQDSWNSLVLADSHGDIITA
Lagerungsbedingungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatorischer Status RUO
Gen-Alias MGC126629
Gebräuchliche Bezeichnung GATA4
Gensymbol GATA4
Spezies Wheat Germ (in vitro)
Rekombinant Recombinant
Proteinmarkierung GST
Expressionssystem wheat germ expression system
Form Liquid
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.