missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. PGC-1 beta Antibody - Azide and BSA Free, R&D Systems™

PGC-1 beta Antibody - Azide and BSA Free, R&D Systems™

Catalog No. 18604792 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
0.02 mL
0.1 mL
Packungsgröße:
0.02 Milliliter
0.10 Milliliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Menge Packungsgröße
18604792 0.02 mL 0.02 Milliliter
18691622 0.1 mL 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Catalog No. 18604792 Lieferant Novus Biologicals Lieferanten-Nr. NBP2942380.02ml

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 Alternative Produkte anzeigen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

PGC-1 beta Polyclonal antibody specifically detects PGC-1 beta in Human, Mouse samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen PGC-1 beta
Anwendungen Western Blot
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 1:500-1:2000
Zusammensetzung PBS (pH 7.3), 50% glycerol
Gen-Alias DKFZp686C1790, ERRL1, PERCFLJ14284, peroxisome proliferator-activated receptor gamma, coactivator 1 beta, PGC1, PGC1Bgamma, coactivator 1, beta, PPARGC1
Wirtsspezies Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 850-950 of human PGC1 beta (NP_001166170.1). SSRELKRRFEVFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSL
Reinigungsverfahren Affinity purified
Menge 0.02 mL
Regulatorischer Status RUO
Forschungsgebiet Breast Cancer, Cancer, Chromatin Research, Diabetes Research, Hypoxia, Lipid and Metabolism, Mitochondrial Markers, Neuroscience, Signal Transduction
Primär oder sekundär Primary
Gen-ID (Entrez) 133522
Zielspezies Human, Mouse
Inhalt und Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotype IgG
Produktlinie Novus
Mehr anzeigen Weniger anzeigen
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.