missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. ABCG4 Antibody - Azide and BSA Free, R&D Systems™

ABCG4 Antibody - Azide and BSA Free, R&D Systems™

Catalog No. 18605011 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
0.02 mL
0.1 mL
Packungsgröße:
0.02 Milliliter
0.10 Milliliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Menge Packungsgröße
18605011 0.1 mL 0.10 Milliliter
18675571 0.02 mL 0.02 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Catalog No. 18605011 Lieferant Novus Biologicals Lieferanten-Nr. NBP2921740.1ml

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 Alternative Produkte anzeigen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

ABCG4 Polyclonal antibody specifically detects ABCG4 in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen ABCG4
Anwendungen Western Blot
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 1:500-1:2000
Zusammensetzung PBS with 50% glycerol, pH7.3.
Gen-Alias ATP-binding cassette, sub-family G (WHITE), member 4, ATP-binding cassette, subfamily G, member 4, putative ABC transporter, WHITE2ATP-binding cassette sub-family G member 4
Wirtsspezies Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 270-370 of human ABCG4 (NP_071452.2). KLYILSQGQCIFKGVVTNLIPYLKGLGLHCPTYHNPADFIIEVASGEYGDLNPMLFRAVQNGLCAMAEKKSSPEKNEVPAPCPPCPPEVDPIESHTFATST
Reinigungsverfahren Affinity purified
Menge 0.1 mL
Regulatorischer Status RUO
Forschungsgebiet ABC Transporters, Lipid and Metabolism
Primär oder sekundär Primary
Gen-ID (Entrez) 64137
Zielspezies Human, Mouse, Rat
Inhalt und Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotype IgG
Produktlinie Novus
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.