missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. p14ARF/CDKN2A Antibody, R&D Systems™

p14ARF/CDKN2A Antibody, R&D Systems™

Catalog No. 18621319 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
100 μg
25 μg
Packungsgröße:
100 Mikroliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Menge Packungsgröße
18621319 25 μg 25 Mikroliter
18635268 100 μg 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Catalog No. 18621319 Lieferant Novus Biologicals Lieferanten-Nr. NBP30552125ul
 Eingeschränkter Artikel
Estimated Shipment: 01-12-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

p14ARF/CDKN2A Polyclonal specifically detects p14ARF/CDKN2A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen p14ARF/CDKN2A
Anwendungen Immunocytochemistry/Immunofluorescence
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Zusammensetzung PBS, pH 7.2, containing 40% glycerol
Gen-Alias ARF, CDK4 inhibitor p16-INK4, CDK4IP14ARF, CDKN2, cell cycle negative regulator beta, CMM2P16-INK4A, Cyclin-dependent kinase 4 inhibitor A, cyclin-dependent kinase inhibitor 2A, cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4), INK4, INK4A, MLMP16INK4, MTS-1, MTS1P14, Multiple tumor suppressor 1, p14, p14ARF, p16, p16-INK4, p16INK4a, p16-INK4a, P19, p19ARF, TP16
Wirtsspezies Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRLGQQPLPRRPGHDDGQRPS
Reinigungsverfahren Affinity purified
Menge 25 μg
Regulatorischer Status RUO
Forschungsgebiet ABC Transporters, Cancer, Cell Biology, Cell Cycle and Replication, Chromatin Research, DNA Repair, Hypoxia, MAP Kinase Signaling, Neuroscience, p53 Pathway, Transcription Factors and Regulators, Tumor Suppressors
Primär oder sekundär Primary
Gen-ID (Entrez) 1029
Zielspezies Human
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotype IgG
Produktlinie Novus
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.