missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. MRPL50 Antibody, R&D Systems™

MRPL50 Antibody, R&D Systems™

Catalog No. 18614387 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
100 μg
25 μL
Packungsgröße:
100 Mikroliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Menge Packungsgröße
18614387 25 μL 25 Mikroliter
18694538 100 μg 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Catalog No. 18614387 Lieferant Novus Biologicals Lieferanten-Nr. NBP26872825ul
  • ONLINE EXCLUSIVE PRICE
    457.09 €
    391.65 € / 25µL
    Save 65.44 €
    14% Off
 Eingeschränkter Artikel
Estimated Shipment: 02-12-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

MRPL50 Polyclonal specifically detects MRPL50 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen MRPL50
Anwendungen Immunocytochemistry, Immunofluorescence
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Zusammensetzung PBS (pH 7.2) and 40% Glycerol
Gen-Alias 39S ribosomal protein L50, mitochondrial, FLJ20493, L50mt, mitochondrial 39S ribosomal protein L50, mitochondrial ribosomal protein L50, MRP-L50FLJ21990
Wirtsspezies Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LGHVVPNSRLHQMCRVRDVLDFYNVPIQDRSKFDELSASNLPPNLKITWS
Reinigungsverfahren Protein A purified
Menge 25 μL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 54534
Zielspezies Human
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotype IgG
Produktlinie Novus
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.