missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. Laminin beta 1 Antibody (CL2970), R&D Systems™

Laminin beta 1 Antibody (CL2970), R&D Systems™

Catalog No. 18603289 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
25 μL
0.1 mL
Unit Size:
0.10 Milliliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Menge Unit Size
18603289 0.1 mL 0.10 Milliliter
18655937 25 μL 25 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18603289 Supplier Novus Biologicals Supplier No. NBP242385
 Eingeschränkter Artikel
Estimated Shipment: 01-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

Laminin beta 1 Monoclonal antibody specifically detects Laminin beta 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Laminin beta 1
Anwendungen Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassifikation Monoclonal
Klon CL2970
Konjugat Unconjugated
Verdünnung Western Blot 1 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200
Zusammensetzung PBS (pH 7.2), 40% Glycerol
Gen-Zugriffsnummer P07942
Gen-Alias CLM, cutis laxa with marfanoid phenotype, Laminin B1 chain, laminin subunit beta-1, laminin, beta 1, Laminin-1 subunit beta, Laminin-10 subunit beta, Laminin-12 subunit beta, Laminin-2 subunit beta, Laminin-6 subunit beta, Laminin-8 subunit beta, MGC142015
Wirtsspezies Mouse
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: GPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRFLEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEF
Reinigungsverfahren Protein A purified
Menge 0.1 mL
Regulatorischer Status RUO
Forschungsgebiet Angiogenesis, Apoptosis, Cancer, Cell Biology, Cellular Markers, Extracellular Matrix, Neuroscience, Signal Transduction, Tumor Suppressors
Primär oder sekundär Primary
Gen-ID (Entrez) 3912
Zielspezies Human
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotype IgG1
Produktlinie Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.