missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. MSH2 Antibody, R&D Systems™

MSH2 Antibody, R&D Systems™

Catalog No. 18610379 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
100 μg
25 μL
Packungsgröße:
100 Mikroliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Menge Packungsgröße
18610379 100 μg 100 Mikroliter
18607298 25 μL 25 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Catalog No. 18610379 Lieferant Novus Biologicals Lieferanten-Nr. NBP268845
 Eingeschränkter Artikel
Estimated Shipment: 01-12-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

MSH2 Polyclonal antibody specifically detects MSH2 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen MSH2
Anwendungen Immunofluorescence
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Zusammensetzung PBS (pH 7.2) and 40% Glycerol
Gen-Alias COCA1, DNA mismatch repair protein Msh2, FCC1, hMSH2, HNPCC, HNPCC1mutS (E. coli) homolog 2 (colon cancer, nonpolyposis type 1), LCFS2, mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli), MutS protein homolog 2
Wirtsspezies Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: FDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPAGAKNLQSVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLA
Reinigungsverfahren Protein A purified
Menge 100 μg
Regulatorischer Status RUO
Forschungsgebiet Breast Cancer, Cancer, Core ESC Like Genes, DNA Repair, Mismatch Repair, Stem Cell Markers, Tumor Suppressors
Primär oder sekundär Primary
Gen-ID (Entrez) 4436
Zielspezies Human
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotype IgG
Produktlinie Novus
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.