missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. ErbB2/Her2 Antibody, R&D Systems™

ErbB2/Her2 Antibody, R&D Systems™

Catalog No. 18476140 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
25 μL
0.1 mL
Packungsgröße:
0.10 Milliliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Menge Packungsgröße
18476140 25 μL 25 Mikroliter
18420501 0.1 mL 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Catalog No. 18476140 Lieferant Novus Biologicals Lieferanten-Nr. NBP18458425ul
 Eingeschränkter Artikel
Estimated Shipment: 01-12-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

ErbB2/Her2 Polyclonal specifically detects ErbB2/Her2 in Human, Mouse samples. It is validated for Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen ErbB2/Her2
Anwendungen Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Zusammensetzung PBS (pH 7.2) and 40% Glycerol
Gen-Alias CD340, CD340 antigen, c-erb B2/neu protein, EC 2.7.10, EGFR2, HER-2, HER2EC 2.7.10.1, herstatin, Metastatic lymph node gene 19 protein, MLN 19, MLN19, NEUHER-2/neu, neuroblastoma/glioblastoma derived oncogene homolog, NGLTKR1, p185erbB2, Proto-oncogene c-ErbB-2, Proto-oncogene Neu, receptor tyrosine-protein kinase erbB-2, Tyrosine kinase-type cell surface receptor HER2, v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2(neuro/glioblastoma derived oncogene homolog), v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastomaderived oncogene homolog (avian)
Wirtsspezies Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: LPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTA
Reinigungsverfahren Immunogen affinity purified
Menge 25 μL
Regulatorischer Status RUO
Forschungsgebiet Breast Cancer, Cancer, Cellular Markers, Core ESC Like Genes, Oncogenes, Phospho Specific, Protein Kinase, Stem Cell Markers, Tumor Suppressors
Primär oder sekundär Primary
Gen-ID (Entrez) 2064
Zielspezies Human, Mouse
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotype IgG
Produktlinie Novus
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.