missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. COX7A1 Antibody - Azide and BSA Free, R&D Systems™

COX7A1 Antibody - Azide and BSA Free, R&D Systems™

Catalog No. 18603710 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
0.02 mL
0.1 mL
Packungsgröße:
0.02 Milliliter
0.10 Milliliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge Packungsgröße
18603710 0.1 mL 0.10 Milliliter
18631621 0.02 mL 0.02 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18603710 Lieferant Novus Biologicals Lieferanten-Nr. NBP2921850.1ml
 Eingeschränkter Artikel
Estimated Shipment: 03-12-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

COX7A1 Polyclonal specifically detects COX7A1 in Human, Mouse, Rat samples. It is validated for ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen COX7A1
Anwendungen ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 1:100 - 1:500, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Zusammensetzung PBS with 50% glycerol, pH7.3.
Gen-Alias COX7AHCOX7A, COX7AM, cytochrome c oxidase subunit VIIa heart/muscle isoform, cytochrome c oxidase subunit VIIa polypeptide 1 (muscle), Cytochrome c oxidase subunit VIIa-H, Cytochrome c oxidase subunit VIIa-M, Cytochrome c oxidase subunit VIIa-muscle, mitochondrial
Wirtsspezies Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-79 of human COX7A1 (NP_001855.1). MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN
Reinigungsverfahren Affinity purified
Menge 0.1 mL
Regulatorischer Status RUO
Forschungsgebiet Cardiovascular Biology, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction
Primär oder sekundär Primary
Gen-ID (Entrez) 1346
Zielspezies Human, Mouse, Rat
Inhalt und Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotype IgG
Produktlinie Novus
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.