missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. CABC1 Antibody, R&D Systems™

CABC1 Antibody, R&D Systems™

Catalog No. 18607218 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
25 μL
100 μL
missing translation for 'unitSize':
100 Mikroliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Menge missing translation for 'unitSize'
18607218 25 μL 25 Mikroliter
18260252 100 μL 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 missing translation for 'options'
This item is not returnable. View return policy
Product Code. 18607218 missing translation for 'mfr' Novus Biologicals missing translation for 'supplierNo' NBP25600625ul
 Eingeschränkter Artikel
Estimated Shipment: 01-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

CABC1 Polyclonal specifically detects CABC1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CABC1
Anwendungen Immunocytochemistry, Immunofluorescence
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
Zusammensetzung PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gen-Alias aarF domain containing kinase 3, chaperone, ABC1 activity of bc1 complex homolog, chaperone, ABC1 activity of bc1 complex homolog (S. pombe), chaperone, ABC1 activity of bc1 complex like (S. pombe), chaperone-ABC1 (activity of bc1 complex, S.pombe)-like, Chaperone-ABC1-like, coenzyme Q8 homolog, EC 2.7.11, EC 2.7.11.-, MGC4849, mitochondrial, SCAR9
Gensymbole COQ8A
Wirtsspezies Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAENFGGPEGEFHFSVPHAAG
Reinigungsverfahren Affinity Purified
Menge 25 μL
Regulatorischer Status RUO
Forschungsgebiet Apoptosis, Protein Kinase
Primär oder sekundär Primary
Gen-ID (Entrez) 56997
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Produkttyp Antibody
Isotype IgG
Produktlinie Novus
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.