missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. CLEC16A Antibody, R&D Systems™

CLEC16A Antibody, R&D Systems™

Catalog No. 18620339 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
25 μL
100 μL
Packungsgröße:
100 Mikroliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Menge Packungsgröße
18620339 25 μL 25 Mikroliter
18286374 100 μL 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Catalog No. 18620339 Lieferant Novus Biologicals Lieferanten-Nr. NBP25715025ul
 Eingeschränkter Artikel
Estimated Shipment: 02-12-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

CLEC16A Polyclonal specifically detects CLEC16A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence, Western Blot.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen CLEC16A
Anwendungen Western Blot, Immunocytochemistry, Immunofluorescence
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Zusammensetzung PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gen-Alias C-type lectin domain family 16, member A, KIAA0350Gop-1, MGC111457, protein CLEC16A
Gensymbole CLEC16A
Wirtsspezies Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EPETQLPLTREEDLIKTDDVLDLNNSDLIACTVITKDGGMVQRFLAVDIYQMSLVEPDVSRLGWGVVKFAGLLQDMQVTGVEDDSRALNITIHKP
Reinigungsverfahren Affinity Purified
Menge 25 μL
Regulatorischer Status RUO
Forschungsgebiet Immunology, Innate Immunity
Primär oder sekundär Primary
Gen-ID (Entrez) 23274
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Produkttyp Antibody
Form Purified
Isotype IgG
Produktlinie Novus
Mehr anzeigen Weniger anzeigen

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.