accessibility menu, dialog, popup

UserName
Bio Techne logo

Bio Techne

Bio-Techne is a global developer, manufacturer, and supplier of high-quality reagents, analytical instruments, and precision diagnostics. Whether you’re at the cutting edge of academic research, translating basic discoveries into therapeutic leads, or at a facility that requires the highest level of diagnostic testing, our award-winning tools and solutions empower scientists and clinicians to achieve reproducible and consistent results. Choosing Bio‑Techne means having confidence that every solution you use will help move you towards better answers.

Top Categories

Antibodies

Antibodies are essential tools for biomedical research as they allow researchers to identify specific proteins or molecules. Our catalog of over 425,000 antibodies from our R&D Systems™ and Novus Biologicals™ brands have been validated for specificity and reproducibility in over 25 species for more than 15 applications, ensuring that you will find one for your research needs.

Find Your Antibodies
Antibodies

Cell Culture Reagents and Assays

Your unique cell cultures require a consistent foundation whether you are using classical or specialty media, sera, supplements, and matrices. Thorough cell characterization is also critical to determine if the phenotype is what you need for your particular application.

Find Your Cell Culture Reagents
Cell Culture Reagents and Assays

ELISA Kits

Have confidence in your results with R&D Systems™ rigorously validated and tested ELISA kits. As the most published ELISA supplier, with more than 30 years of experience designing and optimizing quantitative immunoassays, you can trust that you have publishable, reproducible data every time.

Find Your ELISA Kits
ELISA Kits

Fluorescent Dyes and Probes

Fluorescent and bioluminescent reagents enable highly sensitive and selective visualization of biological events, from single molecule tracking in vitro through to in vivo imaging. Discover our exclusive range of fluorescent probes, indicators, dyes, and stains.

Find Your Dyes and Probes
Fluorescent Dyes and Probes

Recombinant Proteins

Bio-Techne offers over 5,000 R&D Systems™ bioactive recombinant proteins spanning 35 species and multiple research areas. Our portfolio includes cytokines and growth factors, proteins for studying immuno-oncology targets, enzymes, and animal-free and GMP-grade proteins, as well as custom protein development services and more.

Find Your Recombinant Proteins
Recombinant Proteins

Small Molecules and Peptides

Small molecules and peptides can be used in all stages of biological and biomedical research. Bio-Techne’s unique collection of small molecules and peptides includes high quality, novel, and innovative compounds such as enzyme inhibitors, ion channel modulators, GPCR agonists and antagonists, fluorescent probes and dyes, and molecular biology tools.

Find Your Small Molecules
Small Molecules and Peptides

Related Resources

Optimizing Organoid Culture Conditions:
Optimizing Organoid Culture Conditions
An application note demonstrating the value of R&D Systems™ proteins for achieving robust, reproducible organoid culture conditions
Filename
23227_bio_techne_optimizing_organoids_Fisherised_v2.pdf
Size
1 MB
Format
application/pdf
Realize Your Protein and Cell Potential
Realize Your Protein and Cell Potential
Realize your protein and cell potential
Filename
23227_bio_techne_realize_protein_Fisherised.pdf
Size
3 MB
Format
application/pdf
Organ-on-a-Chip Technology:
Organ-on-a-Chip Technology
Progress, challenges, and an exciting future
Filename
23227_bio_techne_organ_on_a_chip_technology_progress_Fisherised.pdf
Size
326 KB
Format
application/pdf

Fisher Scientific Europe Announces a New Distribution Agreement with Bio-Techne in Europe

Paris, France 01-05-2024

 

Thermo Fisher Scientific, a leading provider of laboratory products and services, is pleased to announce a significant milestone in its commitment to providing cutting-edge solutions to its customers. Effective May 1, 2024, Thermo Fisher will enter into a strategic European distribution agreement with Bio-Techne (NASDAQ: TECH), a global life sciences company providing innovative tools and bioactive reagents for the research and clinical diagnostic communities.

This partnership marks an important collaboration between two industry leaders in the fields of scientific research, diagnostics, and biotechnology. Under this agreement, Thermo Fisher, through the Fisher Scientific channel, Europe, will distribute Bio-Techne's extensive portfolio of innovative products, including antibodies, proteins, immunoassay kits, reagents and enzymes to laboratories and research institutions across Europe.

"We are thrilled to forge this partnership with Bio-Techne, a company renowned for its pioneering advancements in the life sciences industry," said Claire Wallace, President, Fisher Scientific channel, Europe. "By adding Bio-Techne's high-quality products to our comprehensive portfolio, we aim to further empower scientists and researchers with the tools they need to drive breakthrough discoveries and advancements in healthcare."

Bio-Techne's state-of-the-art products are designed to accelerate research and improve outcomes in areas including cell and gene therapy, immunology, neuroscience, and more. With this collaboration, Thermo Fisher reinforces its commitment to providing customers with access to the latest technologies and expertise, ultimately advancing scientific knowledge and improving human health.

"We are excited to partner with Thermo Fisher to expand the reach of our products and services throughout Europe," said Kim Kelderman, Bio-Techne’s President and Chief Executive Officer. "By leveraging the Fisher Scientific Channel's extensive European distribution network and industry expertise, we aim to enhance support for researchers and accelerate scientific discoveries that address some of the most pressing challenges in healthcare today."

This distribution agreement underscores Thermo Fisher's dedication to fostering innovation and collaboration within the scientific community. Through strategic partnerships with leading companies like Bio-Techne, Thermo Fisher continues to strengthen its position as a trusted partner for researchers and laboratories across Europe.

About Bio-Techne

Bio-Techne Corporation (NASDAQ: TECH) is a global life sciences company providing innovative tools and bioactive reagents for the research and clinical diagnostic communities. Bio-Techne products assist scientific investigations into biological processes and the nature and progress of specific diseases. They aid in drug discovery efforts and provide the means for accurate clinical tests and diagnoses. With thousands of products in its portfolio, Bio-Techne generated over $1.1 billion in net sales in fiscal year 2023 and has approximately 3,100 employees worldwide.

 

Questions? Reach Out to a Specialist >

 

Filtrerede søgeresultater

Produkter fra nogle af vores leverandører vises ikke i filtrerede søgeresultater. ryd alle filtre for at se disse produkter.

Snævre resultater

Snævre resultater

Kategori

specielle programmer

  • (6,778)

Konjugeret

  • (3)
  • (18,012)
  • (7)
  • (2,819)
  • (5)
  • (8)
  • (17)
  • (19,923)
  • (20,002)
  • (20,044)
  • (21,148)
  • (19,951)
  • (19,949)
  • (19,968)
  • (20,019)
  • (7)
  • (259)
  • (2)
  • (3)
  • (2)
  • (3)
  • (2)
  • (1)
  • (1)
  • (4)
  • (25,396)
  • (14,806)
  • (5)
  • (4)
  • (2)
  • (2)
  • (2)
  • (25,318)
  • (23,137)
  • (24,940)
  • (9)
  • (25,353)
  • (24,323)
  • (30)
  • (13)
  • (24,454)
  • (24,449)
  • (25,049)
  • (38)
  • (24,013)
  • (115)
  • (2)
  • (25,017)
  • (1)
  • (4)
  • (9,893)
  • (24,055)
  • (1,696)
  • (1,695)
  • (23,127)
  • (9,869)
  • (1)
  • (17,998)
  • (14)
  • (2,800)
  • (2,815)
  • (2,807)
  • (5)
  • (6)
  • (5)
  • (4)
  • (19,260)
  • (9)
  • (8)
  • (8)
  • (150)
  • (4)
  • (19)
  • (142)
  • (106,240)
  • (114)
  • (17,428)
  • (16,562)
  • (17,408)

Applikationer

  • (54)
  • (128)
  • (161)
  • (15)
  • (5)
  • (400)
  • (94)
  • (5)
  • (2,001)
  • (624)
  • (1,415)
  • (3)
  • (46)
  • (71)
  • (1)
  • (8)
  • (112)
  • (34,344)
  • (1)
  • (27)
  • (106)
  • (82)
  • (1,484)
  • (357)
  • (249,729)
  • (5,178)
  • (5,079)
  • (5,140)
  • (12)
  • (50)
  • (148,458)
  • (239)
  • (5,797)
  • (3)
  • (6)
  • (301)
  • (6,806)
  • (7)
  • (21)
  • (83)
  • (4,097)
  • (67)
  • (39)
  • (6)
  • (34)
  • (2,809)
  • (1,355)
  • (103,309)
  • (49,246)
  • (318)
  • (26)
  • (139,338)
  • (303,093)
  • (597)
  • (19,979)
  • (18)
  • (232,588)
  • (17)
  • (32)
  • (2)
  • (450)
  • (37,697)
  • (48)
  • (150)
  • (22)
  • (198)
  • (76)
  • (118)
  • (6,196)
  • (94)
  • (8)
  • (6)
  • (69)
  • (3)
  • (117)
  • (964)
  • (2)
  • (9,787)
  • (1)
  • (18)
  • (3)
  • (1,130)
  • (61)
  • (6,233)
  • (153)
  • (1)
  • (3)
  • (385)
  • (3)
  • (7)
  • (713)
  • (1,420)
  • (119)
  • (119)
  • (2,048)
  • (65)
  • (2)
  • (22)
  • (92)
  • (11)
  • (469,323)
  • (436)
  • (11)

Målarter

  • (20)
  • (27)
  • (118)
  • (4)
  • (1,170)
  • (118)
  • (30)
  • (508)
  • (17)
  • (30)
  • (437)
  • (592)
  • (35)
  • (2,333)
  • (149)
  • (15)
  • (14,931)
  • (645)
  • (1,433)
  • (98)
  • (22)
  • (818)
  • (6)
  • (27)
  • (19,681)
  • (555)
  • (4,677)
  • (250)
  • (308)
  • (492)
  • (132)
  • (20)
  • (1,368)
  • (1)
  • (221)
  • (28)
  • (35)
  • (4)
  • (1,099)
  • (91)
  • (9)
  • (910)
  • (72)
  • (1)
  • (2)
  • (6,641)
  • (69)
  • (1)
  • (2,420)
  • (64)
  • (467)
  • (166)
  • (71)
  • (801)
  • (16)
  • (115)
  • (69)
  • (1,772)
  • (13)
  • (164)
  • (23)
  • (5,663)
  • (88)
  • (205)
  • (175)
  • (145)
  • (127)
  • (107)
  • (2,217)
  • (192)
  • (2)
  • (1)
  • (653,903)
  • (413)
  • (1)
  • (1)
  • (1)
  • (87)
  • (37)
  • (71)
  • (288)
  • (201)
  • (278)
  • (17)
  • (72)
  • (10)
  • (93)
  • (263)
  • (639)
  • (663)
  • (2)
  • (8)
  • (88)
  • (11,523)
  • (62)
  • (2)
  • (268,722)
  • (3,134)
  • (1)
  • (15)
  • (269)
  • (8)
  • (45)
  • (3,088)
  • (9)
  • (2)
  • (167)
  • (36)
  • (155)
  • (35)
  • (109)
  • (10,636)
  • (29)
  • (504)
  • (21)
  • (427)
  • (11,848)
  • (66)
  • (229)
  • (2)
  • (9,461)
  • (293)
  • (181,550)
  • (3,576)
  • (1)
  • (174)
  • (320)
  • (9)
  • (15)
  • (19)
  • (134)
  • (27)
  • (3)
  • (640)
  • (2,755)
  • (2,657)
  • (198)
  • (4)
  • (39)
  • (13)
  • (73)
  • (463)
  • (44)
  • (7)
  • (1,005)
  • (9,653)
  • (30)
  • (3)
  • (129)
  • (1,380)
  • (1,229)
  • (3,587)

Klassifikation

  • (411,706)
  • (327,670)

Værtsarter

  • (921)
  • (23)
  • (8)
  • (1,361)
  • (619)
  • (17)
  • (2)
  • (22,757)
  • (42)
  • (50)
  • (398)
  • (8,662)
  • (34)
  • (22)
  • (305,763)
  • (1)
  • (28)
  • (5)
  • (354,280)
  • (28,454)
  • (15,505)
  • (1)
  • (1)

Mængde

  • (1)
  • (2)
  • (1)
  • (1,070)
  • (862)
  • (1,480)
  • (2,819)
  • (1)
  • (1)
  • (1,153)
  • (895)
  • (622,236)
  • (9,556)
  • (7)
  • (806)
  • (55)
  • (1)
  • (8)
  • (1)
  • (3,372)
  • (694)
  • (1,183)
  • (177)
  • (1)
  • (3)
  • (1)
  • (6,071)
  • (544)
  • (1)
  • (3)
  • (2)
  • (4)
  • (11)
  • (1)
  • (1,995)
  • (1,762)
  • (2)
  • (1)
  • (1)
  • (70)
  • (11)
  • (1)
  • (30)
  • (2)
  • (1)
  • (75)
  • (25,503)
  • (39,039)
  • (1)
  • (48)
  • (1)
  • (3)
  • (1)
  • (2)
  • (4)
  • (7)
  • (6)
  • (36)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (15)
  • (1)
  • (2)
  • (1)
  • (7)
  • (50)
  • (334)
  • (1)
  • (3,584)
  • (3,649)
  • (5)
  • (26)
  • (97)
  • (142)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (1,139)
  • (1,705)
  • (2)
  • (7)
  • (7)
  • (86)
  • (5)
  • (1)
  • (82)
  • (5)
  • (198)
  • (7)
  • (1)
  • (3)
  • (4)
  • (11)
  • (525)
  • (9)
  • (2)
  • (13)
  • (445)
  • (3,496)
  • (1)
  • (2)
  • (3)
  • (3)
  • (36)
  • (669)
  • (1)
  • (35)
  • (6)
  • (1)
  • (1)
  • (9)
  • (15)
  • (1)
  • (661)
  • (1)
  • (5)
  • (8)

Isotype

  • (98)
  • (53)
  • (25)
  • (1)
  • (42)
  • (2)
  • (2)
  • (375,860)
  • (16,621)
  • (469)
  • (133,031)
  • (53,001)
  • (654)
  • (27)
  • (53)
  • (7,110)
  • (213)
  • (1,525)
  • (116)
  • (51,192)
  • (13,668)
  • (470)
  • (35)
  • (50,229)
  • (15,999)
  • (543)
  • (3)
  • (23)
  • (515)
  • (1,661)
  • (26)
  • (1,741)
  • (1,002)
  • (42)
  • (862)
  • (152)
  • (32)
  • (396)
  • (282)
  • (28)
  • (1,023)
  • (17)

Regulatorisk status

  • (667,255)

Form

  • (625)
  • (467)
  • (20)
  • (1)
  • (1)
  • (4,073)
  • (2,301)
  • (5)
  • (95)
  • (614,343)
  • (4)
  • (1)
  • (2)
  • (691)
  • (1)

Til brug med (applikation)

  • (1,971)
  • (1,289)
  • (8)
  • (2)
  • (4)
  • (2)
  • (1)
  • (1)
  • (25)
  • (305)
  • (19,327)
  • (2)
  • (4)
  • (37)
  • (48)
  • (86)
  • (3)
  • (29)
  • (26)
  • (6)
  • (3)
  • (10)
  • (546)
  • (18,708)
  • (7)
  • (32)
  • (20)
  • (65)
  • (235)
  • (562)
  • (9)
  • (322)
  • (16)
  • (2)
  • (78)
  • (135)
  • (86)
  • (1)
  • (68)
  • (1)
  • (11)
  • (1)
  • (4)
  • (3,801)
  • (3)
  • (3)
  • (18,629)
  • (6)
  • (1)
  • (5,943)
  • (4)
  • (2)
  • (5)
  • (1)
  • (3)
  • (1)
  • (18,955)
  • (5)
  • (1)

1 – 15 af 903,124 Resultater
1

Separase Antibody (XJ11-1B12) - BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody has been used in 1 publication

Klon XJ11-1B12
Værtsarter Mouse
Form Purified
Konjugeret Unconjugated
Isotype IgG1 κ
Koncentration 0.9 mg/mL
Fortynding Western Blot 1:500
Primær eller sekundær Primary
Genadgangsnr. Q14674
Klassifikation Monoclonal
Antigen Separase
Gene Alias Caspase-like protein ESPL1, EC 3.4.22.49, ESP1extra spindle poles like 1, extra spindle pole bodies homolog 1 (S. cerevisiae), extra spindle poles like 1 (S. cerevisiae), Extra spindle poles-like 1 protein, FLJ46492, KIAA0165separin, Separase
Gensymboler ESPL1
Applikationer Western Blot
Indhold og opbevaring Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Immunogen Maltose-Binding Protein fusion of a C-terminal fragment of human Separase (residues 1866-1996). [UniProt# Q14674]
Målarter Human
Regulatorisk status RUO
Gen-id (Entrez) 9700
Oprensningsmetode Protein G purified
Forskningsdisciplin Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research, DNA Repair, Mitotic Regulators
5

SUSD4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Værtsarter Rabbit
Konjugeret Unconjugated
Isotype IgG
Fortynding Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Primær eller sekundær Primary
Genadgangsnr. Q5VX71
Klassifikation Polyclonal
Antigen SUSD4
Gene Alias FLJ10052, PRO222, sushi domain containing 4, sushi domain-containing protein 4, YHGM196
Gensymboler SUSD4
Applikationer Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Indhold og opbevaring Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: IPSDNSICVQEDCRIPQIEDAEIHNKTYRHGEKLIITCHEGFKIRYPDLHNMVSLCRDDGTWNNLPICQGCLRPLASSNGYVN
Formulering PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Målarter Human
Regulatorisk status RUO
Gen-id (Entrez) 55061
Testspecificitet Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Oprensningsmetode Affinity Purified
9

CD31/PECAM-1 Antibody (MEC13.3) - BSA Free, Novus Biologicals™

Rat Monoclonal Antibody has been used in 17 publications

Klon MEC13.3
Værtsarter Rat
Form Purified
Konjugeret Unconjugated
Isotype IgG2a κ
Koncentration 1.0 mg/mL
Fortynding Flow Cytometry 2.5 ug/ml, Immunohistochemistry 1:100-1:500, Immunocytochemistry/Immunofluorescence 1:500 - 1:1000, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Frozen 1:100, In vitro assay reported in scientific literature (PMID 24647208), In vivo assay reported in scientific literature, Flow (Cell Surface) 2.5 ug/ml, CyTOF-ready
Primær eller sekundær Primary
Klassifikation Monoclonal
Antigen CD31/PECAM-1
Gene Alias adhesion molecule, CD31, CD31 antigen, CD31/EndoCAM, EndoCAM, FLJ34100, FLJ58394, GPIIA′, MEC 13.3 CD31, MEC 13.3 Clone, PECA1, PECAM-1, PECAM-1, CD31/EndoCAM, platelet endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1, platelet/endothelial cell adhesion molecule
Gensymboler PECAM1
Applikationer Flow Cytometry,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunoprecipitation,Immunohistochemistry (Frozen),In vitro Assay,CyTOF
Indhold og opbevaring Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Immunogen This CD31/PECAM-1 Antibody (MEC13.3) was developed against mouse endothelial cell line T-end.
Målarter Human,Mouse
Regulatorisk status RUO
Gen-id (Entrez) 5175
Molekylvægt af antigen 82.5 kDa
Oprensningsmetode Protein G purified
Forskningsdisciplin Angiogenesis, Cancer, Cellular Markers, Embryonic Stem Cell Markers, Endothelial Cell Markers, Hematopoietic Stem Cell Markers, Immunology, Signal Transduction, Stem Cell Markers
13

Novus Biologicals Recombinant Human alpha-Synuclein Active, Pre-formed Fibrils, (Type 1), A53T Mutant Protein

Gene Alias alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein
Opbevaringskrav Store at -80C. Avoid freeze-thaw cycles.
Gen symbol SNCA
Formulering PBS pH 7.4
Renhed eller kvalitetsklasse >95%, by SDS-PAGE
Gen-id (Entrez) 6622
Forskningskategori Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience
Protein alpha-Synuclein
Til brug med (applikation) Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot
15

MAP2 Antibody, Novus Biologicals™

Goat Polyclonal Antibody

Værtsarter Goat
Form Purified
Konjugeret Unconjugated
Isotype IgG1
Koncentration 1 mg/mL
Fortynding Western Blot 1:2000, Immunohistochemistry 1:1000-1:2000, Immunocytochemistry/ Immunofluorescence 1:1000-1:2000
Primær eller sekundær Primary
Klassifikation Polyclonal
Antigen MAP2
Gene Alias DKFZp686I2148, MAP-2, MAP2A, MAP2B, MAP2C, Microtubule Associated Protein 2, microtubule-associated protein 2, MTAP2
Applikationer Western Blot,Immunohistochemistry,Immunofluorescence
Indhold og opbevaring Store at 4°C short term. Store at -20°C long term. Avoid freeze-thaw cycles.
Immunogen MAP2
Formulering 50% PBS, 50% glycerol
Målarter Human,Mouse,Rat
Regulatorisk status RUO
Gen-id (Entrez) 4133
Oprensningsmetode Immunogen affinity purified
Forskningsdisciplin Cell Biology, Cellular Markers, MAP Kinase Signaling, Neuroscience, Stem Cell Markers

Bio Techne