missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ VDAC2 Recombinant Protein (P02)
335.00 € - 508.00 €
Specifications
Accession Number | AAH00165 |
---|---|
For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulation | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
Gene ID (Entrez) | 7417 |
Molecular Weight (g/mol) | 57.86 |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16181812
|
Abnova™
H00007417-P02.10UG |
10 ug |
335.00 €
10µg |
Estimated Shipment: 05-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
16191812
|
Abnova™
H00007417-P02.25UG |
25 ug |
508.00 €
25µg |
Estimated Shipment: 05-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
AAH00165 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
57.86 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
VDAC2 | |
Human | |
Recombinant | |
Solution |
Antibody Production, ELISA, Protein Array, Western Blot | |
7417 | |
VDAC2 (Human) Recombinant Protein (P02) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA | |
FLJ23841 | |
VDAC2 | |
Wheat Germ (in vitro) | |
GST |