missing translation for 'onlineSavingsMsg'
Learn More

ST8SIA4 Recombinant Protein, Abnova

Marke:  Abnova H00007903-P01.10ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16182182

  • 310.00 € / 10 Mikrogramm


Verfügbar ab
19-02-2021
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spezifikation

Spezifikation

AAH27866
Solution
7903
ST8SIA4 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ST8SIA4
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
44.22
8
Glutathione Sepharose 4 Fast Flow
10 ug
MRSIRKKWTICTISLLLIFYKTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR
MGC34450|MGC61459|PST|PST1|SIAT8D|ST8SIA-IV
ST8SIA4
Wheat Germ (in vitro)
GST
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation