missing translation for 'onlineSavingsMsg'
Learn More

S100A10 Recombinant Protein, Abnova

Brand:  Abnova H00006281-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100482

  • 341.70 € / 10µg

Estimated Shipment: 14-01-2022
Add to basket

Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH15973
Solution
6281
S100A10 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
S100A10
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
36.41
8
Glutathione Sepharose 4 Fast Flow
10 ug
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
42C/ANX2L/ANX2LG/CAL1L/CLP11/Ca[1]/GP11/MGC111133/P11/p10
S100A10
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Promotions

Promotions