missing translation for 'onlineSavingsMsg'
Learn More

RAP2A Recombinant Protein, Abnova

Human RAP2A full-length ORF recombinant protein with GST-tag at N-terminal

Brand:  Abnova H00005911-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100062

  • 482.88 € / 25µg


Estimated Shipment
07-06-2021
Add to basket

Description

Description

RAP2A, member of RAS oncogene family

  • Theoretical MW (kDa): 45.87
  • Preparation method: In vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 fast flow
  • Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ

Best when used within three months from the date of receipt.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH41333
Solution
5911
RAP2A (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
RAP2A
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
45.87
8
Glutathione Sepharose 4 Fast Flow
25 ug
MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ
K-REV|KREV|RAP2|RbBP-30
RAP2A
Wheat Germ (in vitro)
GST
Videos
SDS
Documents