missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PTCH1 (Human) Recombinant Protein

Human PTCH1 partial ORF (NP_000255.2, 651 a.a. - 750 a.a.) recombinant protein with GST tag at N-terminal.

Marke:  Abnova™ H00005727-Q02.25ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16183725

  • 467.00 € / 25 Mikrogramm


Verfügbar ab
15-02-2021
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

  • Sequence: AHETQITMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDTLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTKWTLSSFAEKHYAPFLLKPKAK
Spezifikation

Spezifikation

NP_000255.2
patched homolog 1 (Drosophila)
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PTCH1
GST
5727
Wheat germ expression system
25 μg
BCNS, FLJ26746, FLJ42602, HPE7, NBCCS, PTC, PTC1, PTCH, PTCH11
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation