missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PRKCH (Human) Recombinant Protein

Human PRKCH full-length ORF ( AAH01000, 1 a.a. - 41 a.a.) recombinant protein with GST-tag at N-terminal.

Marke:  Abnova™ H00005583-P01.25ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16139571

  • 458.00 € / 25 Mikrogramm


Verfügbar ab
22-09-2020
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

  • Sequence: MALEIVDNEMRFYEVYRSTYERLSLWAWDVNRSQKEGKCEE
Spezifikation

Spezifikation

AAH01000
protein kinase C, eta
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PRKCH
GST
5583
Wheat germ expression system
25 μg
MGC26269, MGC5363, PKC-L, PKCL, PRKCL, nPKC-eta
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Dokumentation