missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PPM1B (Human) Recombinant Protein

Human PPM1B full-length ORF ( AAH12002, 1 a.a. - 192 a.a.) recombinant protein with GST-tag at N-terminal.

Marke:  Abnova™ H00005495-P01.10ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16139411

  • 302.00 € / 10 Mikrogramm


Verfügbar ab
24-09-2020
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

  • Sequence: MSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI
Spezifikation

Spezifikation

AAH12002
protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PPM1B
GST
5495
Wheat germ expression system
10 μg
MGC21657, PP2C-beta-X, PP2CB, PP2CBETA, PPC2BETAX
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Dokumentation