missing translation for 'onlineSavingsMsg'
Learn More

POLE3 Recombinant Protein, Abnova

Brand:  Abnova H00054107-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100473

  • 518.16 € / 25µg

Estimated Shipment: 14-01-2022
Add to basket

Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH03166
Solution
54107
POLE3 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
POLE3
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
41.91
8
Glutathione Sepharose 4 Fast Flow
25 ug
MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN
CHARAC17/CHRAC17/YBL1/p17
POLE3
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Promotions

Promotions