missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PLA2G1B (Human) Recombinant Protein

Human PLA2G1B full-length ORF ( AAH05386, 17 a.a. - 70 a.a.) recombinant protein with GST-tag at N-terminal.

Marke:  Abnova™ H00005319-P01.10ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16139151

  • 302.00 € / 10 Mikrogramm


Verfügbar ab
24-09-2020
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

  • Sequence: SGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKQKQRV
Spezifikation

Spezifikation

AAH05386
phospholipase A2, group IB (pancreas)
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PLA2G1B
GST
5319
Wheat germ expression system
10 μg
MGC119834, MGC119835, PLA2, PLA2A, PPLA2
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Dokumentation