missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PIK3CA (Human) Recombinant Protein

Human PIK3CA partial ORF ( NP_006209, 959 a.a. - 1068 a.a.) recombinant protein with GST-tag at N-terminal.

Marke:  Abnova™ H00005290-Q01.10ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16139091

  • 302.00 € / 10 Mikrogramm


Verfügbar ab
22-09-2020
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

  • Sequence: DFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
Spezifikation

Spezifikation

NP_006209
phosphoinositide-3-kinase, catalytic, alpha polypeptide
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PIK3CA
GST
5290
Wheat germ expression system
10 μg
MGC142161, MGC142163, PI3K, p110-alpha
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Dokumentation