missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ MYH3 (Human) Recombinant Protein

Human MYH3 partial ORF ( NP_002461.1, 2 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00004621-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16101565

  • 341.70 € / 10µg

Estimated Shipment: 24-01-2022
Add to basket

Description

Description

  • Sequence: SSDTEMEVFGIAAPFLRKSEKERIEAQNQPFDAKTYCFVVDSKEEYAKGKIKSSQDGKVTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAMLTHLNEP
Specifications

Specifications

NP_002461.1
myosin, heavy chain 3, skeletal muscle, embryonic
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MYH3
GST
4621
Wheat germ expression system
10 μg
HEMHC, MYHC-EMB, MYHSE1, SMHCE
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Promotions

Promotions