missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ KLK3 (Human) Recombinant Protein

Human KLK3 full-length ORF ( AAH05307, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00000354-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16101741

  • 341.70 € / 10µg

Estimated Shipment: 18-01-2022
Add to basket

Description

Description

  • Sequence: MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDVSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKLMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Specifications

Specifications

AAH05307
kallikrein-related peptidase 3
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KLK3
GST
354
Wheat germ expression system
10 μg
APS, KLK2A1, PSA, hK3
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Promotions

Promotions