missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ KLK3 (Human) Recombinant Protein

Human KLK3 full-length ORF ( AAH05307, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal.

335.00 € - 508.00 €

Accession Number	AAH05307
Gene ID (Entrez)	354
Name	kallikrein-related peptidase 3
Preparation Method	Wheat germ expression system
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16101741 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00000354-P01.10UG	10 μg	335.00 € 10µg View alternative products Save Up to »	Estimated Shipment: 31-05-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

16111741 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00000354-P01.25UG	25 μg	508.00 € 25µg View alternative products Save Up to »	Estimated Shipment: 31-05-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDVSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKLMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

Specifications

Accession Number	AAH05307
Name	kallikrein-related peptidase 3
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Gene Alias	APS, KLK2A1, PSA, hK3
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Gene ID (Entrez)	354
Preparation Method	Wheat germ expression system
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	KLK3
Protein Tag	GST

Description