missing translation for 'onlineSavingsMsg'
Learn More

KCTD4 Recombinant Protein, Abnova

Brand:  Abnova H00386618-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100444

  • 518.16 € / 25µg

Estimated Shipment: 24-01-2022
Add to basket

Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH18063
Solution
386618
KCTD4 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KCTD4
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
54.23
8
Glutathione Sepharose 4 Fast Flow
25 ug
MERKINRREKEKEYEGKHNSLEDTDQGKNCKSTLMTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHYFIDRDGLLFRHVLNFLRNGELLLPEGFRENQLLAQEAEFFQLKGLAEEVKSRWEKEQLTPRETTFLEITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNIIRFKYFIKSENGTRLVLKEDNTFVCTLETLKFEAIMMALKCGFRLLTSLDCSKGSIVHSDALHFIK
bA321C24.3
KCTD4
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Promotions

Promotions