missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ IDI1 (Human) Recombinant Protein

Human IDI1 full-length ORF ( AAH05247.1, 1 a.a. - 228 a.a.) recombinant protein with GST-tag at N-terminal.

Marke:  Abnova™ H00003422-P01.25ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16139804

  • 458.00 € / 25 Mikrogramm


Auf Lager, versandfertig: 5
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

  • Sequence: MMPEINTNHLDKQQVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYRM
Spezifikation

Spezifikation

AAH05247.1
isopentenyl-diphosphate delta isomerase 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
IDI1
GST
3422
Wheat germ expression system
25 μg
IPP1, IPPI1
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Dokumentation