missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZNRF1 Partial ORF (NP_115644, 74 a.a. - 178 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00084937-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100967

  • 341.70 € / 10µg

Estimated Shipment: 18-01-2022
Add to basket

Description

Description

In a study identifying genes in rat that are upregulated in response to nerve damage, a gene which is highly expressed in ganglia and in the central nervous system was found. The protein encoded by the rat gene contains both a zinc finger and a RING finger motif and is localized in the endosome/lysosome compartment, indicating that it may be involved in ubiquitin-mediated protein modification. The protein encoded by this human gene is highly similar in sequence to that encoded by the rat gene. [provided by RefSeq]

Sequence: PASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLT
Specifications

Specifications

NP_115644
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.29kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLT
RUO
ZNRF1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
84937
ZNRF1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp434E229/FLJ14846/MGC15430/NIN283
ZNRF1
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions