missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZNF496 Partial ORF (NP_116141, 485 a.a. - 585 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00084838-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100907

  • 518.16 € / 25µg

Estimated Shipment: 14-01-2022
Add to basket

Description

Description

Sequence: HLQPDRLQPVEKREQAASEDADKGPKEPLENGKAKLSFQCCECGKAFQRHDHLARHRSHFHLKDKARPFQCRYCVKSFTQNYDLLRHERLHMKRRSKQALN
Specifications

Specifications

NP_116141
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.85kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
HLQPDRLQPVEKREQAASEDADKGPKEPLENGKAKLSFQCCECGKAFQRHDHLARHRSHFHLKDKARPFQCRYCVKSFTQNYDLLRHERLHMKRRSKQALN
RUO
ZNF496
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
84838
ZNF496 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC15548/NIZP1/ZKSCAN17
ZNF496
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions