missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZNF287 Partial ORF (NP_065704.1, 231 a.a. - 330 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00057336-Q01.25ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16139076

  • 458.00 € / 25 Mikrogramm


Verfügbar ab
24-09-2020
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: PEWETKAQACTPVEDMSKLTKEETHTIKLEDSYDYDDRLERRGKGGFWKIHTDERGFSLKSVLSQEYDPTEECLSKYDIYRNNFEKHSNLIVQFDTQLDN
Spezifikation

Spezifikation

NP_065704.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PEWETKAQACTPVEDMSKLTKEETHTIKLEDSYDYDDRLERRGKGGFWKIHTDERGFSLKSVLSQEYDPTEECLSKYDIYRNNFEKHSNLIVQFDTQLDN
RUO
ZNF287
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
57336
ZNF287 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC126536|MGC141923|ZKSCAN13
ZNF287
Yes
Videos
Dokumentation