missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZBTB33 Partial ORF (AAH42753, 564 a.a. - 673 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00010009-Q01.25ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16181626

  • 467.00 € / 25 Mikrogramm


Verfügbar ab
24-02-2021
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

KAISO is a transcriptional regulator that binds, via its zinc fingers, to DNA sequences containing methylated CGCG or to the consensus KAISO-binding site (KBS) TCCTGCNA (Filion et al., 2006 [PubMed 16354688]).[supplied by OMIM]

Sequence: QFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSSTIPAMKDDGIGYKVDTGKEPPVGTTTSTQNKPMTWEDIFIQQENDSIFKQNVTDGSTEFEFIIPESY
Spezifikation

Spezifikation

AAH42753
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
QFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSSTIPAMKDDGIGYKVDTGKEPPVGTTTSTQNKPMTWEDIFIQQENDSIFKQNVTDGSTEFEFIIPESY
RUO
ZBTB33
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
10009
ZBTB33 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ZNF-kaiso|ZNF348
ZBTB33
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation