missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human WIF1 Partial ORF (NP_009122, 29 a.a. - 138 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00011197-Q01.25ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16183866

  • 467.00 € / 25 Mikrogramm


Verfügbar ab
18-02-2021
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: GPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGF
Spezifikation

Spezifikation

NP_009122
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGF
RUO
WIF1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
11197
WIF1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
WIF-1
WIF1
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation