missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human WDR19 Partial ORF (NP_079408, 1 a.a. - 99 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00057728-Q01.10ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16139246

  • 302.00 € / 10 Mikrogramm


Auf Lager, versandfertig: 1
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: MKRIFSLLEKTWLGAPIQFAWQKTSGNYLAVTGADYIVKIFDRHGQKRSEINLPGNCVAMDWDKDGDVLAVIAEKSSCIYLWDANTNKTSQLDNGMRDQ
Spezifikation

Spezifikation

NP_079408
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MKRIFSLLEKTWLGAPIQFAWQKTSGNYLAVTGADYIVKIFDRHGQKRSEINLPGNCVAMDWDKDGDVLAVIAEKSSCIYLWDANTNKTSQLDNGMRDQ
RUO
WDR19
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
57728
WDR19 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ23127|KIAA1638|ORF26|PWDMP
WDR19
Yes
Videos
Dokumentation