missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human UHRF2 Partial ORF (NP_690856, 81 a.a. - 180 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00115426-Q01.25ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16181487

  • 467.00 € / 25 Mikrogramm


Verfügbar ab
22-02-2021
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. [provided by RefSeq]

Sequence: PGTSTQIEAKPCSNSPPKVKKAPRVGPSNQPSTSARARLIDPGFGIYKVNELVDARDVGLGAWFEAHIHSVTRASDGQSRGKTPLKNGSSCKRTNGNIKH
Spezifikation

Spezifikation

NP_690856
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PGTSTQIEAKPCSNSPPKVKKAPRVGPSNQPSTSARARLIDPGFGIYKVNELVDARDVGLGAWFEAHIHSVTRASDGQSRGKTPLKNGSSCKRTNGNIKH
RUO
UHRF2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
115426
UHRF2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp434B0920|DKFZp686G0837|MGC33463|NIRF|RNF107|URF2
UHRF2
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation