missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TP53RK Partial ORF (AAH09727, 154 a.a. - 253 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00112858-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16101357

  • 518.16 € / 25µg

Estimated Shipment: 24-01-2022
Add to basket

Description

Description

Sequence: HDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG
Specifications

Specifications

AAH09727
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
HDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG
RUO
TP53RK
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
112858
TP53RK (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BUD32/C20orf64/Nori-2/Nori-2p/PRPK/dJ101A2
TP53RK
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions