missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TINAG Partial ORF (NP_055279.2, 2 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00027283-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16085445

  • 341.70 € / 10µg

Estimated Shipment: 21-01-2022
Add to basket

Description

Description

TINAG is a basement membrane glycoprotein initially identified as a target of antibodies in some forms of immunologically mediated tubulointerstitial nephritis.[supplied by OMIM]

Sequence: WTGYKILIFSYLTTEIWMEKRYLSQREVDLEAYFTRNHTVLQGTRFKRAIFQGQYCRNFGCCEDRDDGCVTEFYAANALCYCDKFCDRENSDCCPDYKS
Specifications

Specifications

NP_055279.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
WTGYKILIFSYLTTEIWMEKRYLSQREVDLEAYFTRNHTVLQGTRFKRAIFQGQYCRNFGCCEDRDDGCVTEFYAANALCYCDKFCDRENSDCCPDYKS
RUO
TINAG
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
27283
TINAG (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
TIN-AG/TIN1/TIN2
TINAG
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions